Bacterial taxon 373153
Protein WP_000567603.1
hypothetical protein
Streptococcus pneumoniae D39
Gene cps2B, UniProt Q9ZII8
>WP_000567603.1|Streptococcus pneumoniae D39|hypothetical protein
MIDVHSHIVFDVDDGPKSREESKALLAESYRQGVRTIVSTSHRRKGMFETPEEKIAENFLQVREIAKEVADDLVIAYGAEIYYTPDVLDKLGKKRIPTLNDSRYALIEFSMNTPYRDIHSALSKILMSGITPVIAHIERYDALGNNEKRVRELIDMGCYTQVNSSHVLKPKLFGERYKFMKKRAQYFLEQDLVHVIASDMHNLDGRPPHMAEAYDLVTQKYGEAKAQELFIDNPRKIVMDQLI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.1 | -1.10143544992823 | 6.5e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.94 | -0.94478319968406 | 3.5e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.78 | -0.778729492056693 | 0.00015 | 27678244 | |
Retrieved 3 of 1 entries in 2.1 ms
(Link to these results)