Bacterial taxon 373153
Protein WP_000375179.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMR9
>WP_000375179.1|Streptococcus pneumoniae D39|hypothetical protein
MDRKERQKIEQQRREMALTNTFFNRYLLLRYSIALFFFGNIYWLLNQFISPSLIIIFPIMLIVFSILATVEQFKLYGNRKEKLGITLMFVRIQMLISIGLLVLTWTSWFTNLFPIFENNQVARLFVFVVLLLGLVLSLLDIRRIKKIYKRTDKAYQQFVQLEKNSLRL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.68 | 2.68273955044806 | 1.0e-24 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.61 | 2.6133792543282 | 7.9e-24 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.3 | 2.2969165270871 | 1.9e-18 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)