Bacterial taxon 373153
Protein WP_000933479.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNW2
>WP_000933479.1|Streptococcus pneumoniae D39|hypothetical protein
MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGVPGIYPGWGNQGMSPNRGAFDWTIDLADGLFGRRRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●● 6.58 | 6.5768160539713 | 2.5e-204 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●●● 5.85 | 5.8515563508925 | 8.2e-162 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.09 | 1.08744367496598 | 8.8e-7 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)