Bacterial taxon 373153
Protein WP_000291598.1
hypothetical protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP46
>WP_000291598.1|Streptococcus pneumoniae D39|hypothetical protein
MYYLPVDFYRYLIGREDQSVNEQVMIKCIDQQLKVNRLLIDQLDLSQVSHPKMREYLLNHIELTTVISSTLLNRSGTAEHLAKKRQLWTYIQQKNPEVFQAIRKTMLSRLTKHSVLPDRKLSNVVYQITKSVYGFN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.14 | -1.14038947991311 | 8.7e-19 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.96 | -0.959493124492263 | 1.3e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.76 | -0.762832443977 | 3.1e-9 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)