Bacterial taxon 373153
Protein WP_000122904.1
helix-turn-helix transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZKX7
>WP_000122904.1|Streptococcus pneumoniae D39|helix-turn-helix transcriptional regulator
MSYYDFVKDYMKVDECKNNEKYSSAGHTFCWKKENSTYAEGLYWFYEGGSFIIDIHDFYIKEEVVQNSTYSMSDYVSIYSSYIVSANGEKFNPYQTITANSLCTFDFDNIKDDFVFLLHENCCYLAVSIGFKKELIEKHLASININPESFYSTLLQPNQIILTKALERVAMEILNCKMDAPAADFFFKAKANEWISIVIDTYLNRKKYKIEIDDDKALEDVARFLDDHFATNVNQGTLEKISKMSGTKLKNLFKEKYCQSITEYTQRKRMNVAETLLLNTELPIKEIAESVGYSSASKFSIYYKRYKGKLPSEVRNLACKHHNFKCDYCD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.1 | 2.10367132543316 | 1.3e-47 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.09 | 2.09277613943782 | 3.5e-47 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.44 | 1.44045680032596 | 4.4e-23 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)