Bacterial taxon 373153
Protein WP_000579612.1
helix-turn-helix transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMN0
>WP_000579612.1|Streptococcus pneumoniae D39|helix-turn-helix transcriptional regulator
MIGKNIKSLRKTHDLTQPEFARIIGISRNSLSRYENGTSSVSTELIDIICQKFNVSYVDIVGEDKMLNPVEDYELTLKIEIVKERGANLLSRLYRYQDSQGISIDDESNPWILMSDDLSDLIHTNIYLVETFDEIERYSGYLDGIERMLEISEKRMVA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.53 | 2.53336978546772 | 7.4e-59 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.49 | 2.48742931524989 | 4.9e-56 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.29 | 2.28943038364245 | 8.3e-48 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)