Bacterial taxon 373153
Protein WP_001819358.1
helix-turn-helix transcriptional regulator
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZM33
>WP_001819358.1|Streptococcus pneumoniae D39|helix-turn-helix transcriptional regulator
MEGCPSELFSKEEILESDMRVAIMSELIEARYEQGISQKKLEEVSGISQPVIARMETGKTSPQLDTVLKVLASLGKTLAVVRLEQGKS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.4 | -2.40400427366171 | 1.2e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ -2.15 | -2.15195539526594 | 1.4e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.36 | -1.36028551975031 | 0.0021 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)