Bacterial taxon 373153
Protein WP_001096142.1
GyrI-like domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPL8
>WP_001096142.1|Streptococcus pneumoniae D39|GyrI-like domain-containing protein
MAKLEVKDNKKLVLKSVICKKLHDTKVEDVDQEINRFHQHLQLLKAQIFGPLIVKSCGTTIHDDGLITTDFEFYIQAHNAQQYSNIYDVQDSISVPYCLYVRFEDSPEYLQYAYSKLDLYVYENDIQTDGIVYTVYVNSSPEKMVVDIFIPIVSL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.23 | 1.22617489993254 | 1.2e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.13 | 1.13480788106287 | 4.5e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.06 | 1.06370090974786 | 5.0e-9 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)