Bacterial taxon 373153
Protein WP_000775044.1
guanylate kinase
Streptococcus pneumoniae D39
Gene gmk, UniProt A0A0H2ZPY5
>WP_000775044.1|Streptococcus pneumoniae D39|guanylate kinase
MADRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDGVDYFFRTREEFEELIRQGQMLEYAEYVGNYYGTPLTYVNETLDKGIDVFLEIEVQGALQVKKKVPDAVFIFLTPPDLDELQDRLVGRGTDSAEVIAQRIEKAKEEIALMREYDYAIVNDQVSLAAERVKCVIEAEHFCVDRVIGHYQEMLPKSPTTR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.73 | 0.72969375307086 | 1.3e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.63 | 0.627107564871922 | 2.3e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.5 | 0.499455039624269 | 4.6e-7 | 27678244 | |
Retrieved 3 of 1 entries in 2 ms
(Link to these results)