Bacterial taxon 373153
Protein WP_000380915.1
GTP cyclohydrolase I FolE
Streptococcus pneumoniae D39
Gene folE, UniProt Q04MF9
>WP_000380915.1|Streptococcus pneumoniae D39|GTP cyclohydrolase I FolE
MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIIDDNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLNIEVADALMDYLGAKGAFVIIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYRLMGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.58 | -0.575375422588404 | 0.00013 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.33 | -0.32580235229283 | 0.034 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.32 | -0.322006933836639 | 0.035 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)