Host taxon 9606
Protein NP_001186670.1
growth arrest and DNA damage-inducible protein GADD45 alpha isoform 2
Homo sapiens
Gene GADD45A, UniProt P24522
>NP_001186670.1|Streptococcus pneumoniae D39|growth arrest and DNA damage-inducible protein GADD45 alpha isoform 2
MTLEEFSAGEQKTESDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.42 | -1.4153125112507 | 6.9e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.98 | -0.982958814376082 | 1.6e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.45 | 0.450735971099753 | 0.022 | 27678244 | |
Retrieved 3 of 2 entries in 1.5 ms
(Link to these results)