Bacterial taxon 373153
Protein WP_000155429.1
GNAT family N-acetyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRB5
>WP_000155429.1|Streptococcus pneumoniae D39|GNAT family N-acetyltransferase
MTIRFEEKVSTENAQFVCQWSNSLGKSFQEQWMGPRIPFLLTLQALEGVFSIFDEQEFVGFIQKIRLEDSNLHIGRFFINPQKQEQGLGSQALRKFVSLAFENEDIDSISLNVFEANQRAQNLYQKEGFEIVQMVEAPVRKYSILKLE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.43 | 1.43260592412736 | 1.5e-20 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.24 | 1.24279499852868 | 3.1e-15 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.1 | 1.10322358828848 | 2.1e-12 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)