Bacterial taxon 373153
Protein WP_000405290.1
GNAT family N-acetyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNW5
>WP_000405290.1|Streptococcus pneumoniae D39|GNAT family N-acetyltransferase
MEIPIKIIQASKSDLPEIGALQTSSFPAEKQQLSHILEESIRKCADTFLLARDENQLLGYILSSPQSDNPQCLKVHSLVIESDHQRQGLGTLLLAALKEVAVELDYKGIRLESPDELLSYFEMNGFVDEEATLLYATSQGYSMIWFNPFYLEEQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.62 | -0.619877986673381 | 2.8e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.6 | -0.596028598914078 | 5.6e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.39 | -0.394898965086332 | 0.0032 | 27678244 | |
Retrieved 3 of 1 entries in 1.7 ms
(Link to these results)