Bacterial taxon 373153
Protein WP_000702436.1
GNAT family N-acetyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQ52
>WP_000702436.1|Streptococcus pneumoniae D39|GNAT family N-acetyltransferase
MKIRQARLEDLDRIVELEFENFSVEEAIPPSVFEAHLREIQTSFLVAEKEGRIMGYIEGPVGLHRHLQDQSFTEEIKDYSHEPGGYISVTCLSIAKEAQGLGLGQKLLTALKEVALEDERDGINLTCHDYLIAYYEKHGFVNEGQSQSTFAGETWYDMVWEMKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.75 | -0.749812652404556 | 1.1e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.57 | -0.57450896303951 | 1.7e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.35 | -0.351630300755819 | 0.0093 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)