Bacterial taxon 373153
Protein WP_001028733.1
GNAT family N-acetyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNU3
>WP_001028733.1|Streptococcus pneumoniae D39|GNAT family N-acetyltransferase
MNIWTKLAMFSFFETDRLYLRPFFFSDSQDFREIASNPENLQFIFPTQASLEESQYALANYFMKSPLGVWAICDQKNQQMIGSIKFEKLDEIKKEAELGYFLRKDAWSQGFMTEVVRKICQLSFEEFGLKQLSIITHLENEASQRVALKSGFSLFRQFKGSDRYTRKMRDYLEFRYVKGEFNE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.69 | -1.69461092720124 | 1.1e-71 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.22 | -1.21521906737531 | 3.9e-37 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.02 | -1.0212096842325 | 8.6e-27 | 27678244 | |
Retrieved 3 of 1 entries in 1.4 ms
(Link to these results)