Bacterial taxon 373153
Protein WP_000333647.1
GNAT family N-acetyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNK3
>WP_000333647.1|Streptococcus pneumoniae D39|GNAT family N-acetyltransferase
MCFVPYYKVNHCEEAFAWYQDVNLVYLVDGVKLPYSQATLEAMYSYLDRHGELFWIEVKEKGEWFPIGDITLSQDNLPIVIGNSAYQHRGLGKKILSALIELARVKGWKELRVKEIYTYNHASRRCFKSLGFVENGATEKGRSFILELV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.34 | -1.34491941890324 | 8.6e-25 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.06 | -1.05713696608128 | 3.9e-16 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.95 | -0.951337608598749 | 3.5e-13 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)