Bacterial taxon 373153
Protein WP_000628392.1
GNAT family N-acetyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRB7
>WP_000628392.1|Streptococcus pneumoniae D39|GNAT family N-acetyltransferase
MITIKKQEIVKLEDVLHLYQAVGWTNYTHQPEMLEQALSHSLVIYLALDGDAVVGLIRLVGDGFSSVLVQDLIVLPIYQRQGIGSALMKEALEDYKDAYQVQLVTEETERTLGFYRSMGFEILSTYNCIGMTWMNRKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.97 | 0.965461329137054 | 5.5e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.55 | 0.553964933238791 | 2.6e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.38 | 0.37705137946285 | 0.0048 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)