Bacterial taxon 373153
Protein WP_000423414.1
GNAT family N-acetyltransferase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZS14
>WP_000423414.1|Streptococcus pneumoniae D39|GNAT family N-acetyltransferase
MELRRPRLADKKAVLDMMTEFEKFQSPHDGGFWDTENFVYEDWLESNQEQEMGINLPEGWVPAIQLVAFSEKGQAVGFLNLRLRLSNFLLEEGGHIGYSIRPSERGKGYAKETLRQGLQVAKEKNIKKALVTCSVNNPASRAVILANGGIFEDARNGVERYWIEVANE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.41 | 2.40505132071058 | 1.9e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.02 | 2.01857625869161 | 8.9e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.98 | 1.98175824560164 | 3.0e-16 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)