Bacterial taxon 373153
Protein WP_000901567.1
GlsB/YeaQ/YmgE family stress response membrane protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN85
>WP_000901567.1|Streptococcus pneumoniae D39|GlsB/YeaQ/YmgE family stress response membrane protein
MLGSMFVGLLVGFLAGAMTNRGERMGCFGKMFLGWIGAFLGHLLFGTWGPVLSGTAIIPAVLGAMIVLAIFWRRGS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.95 | 0.953957293727571 | 2.0e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.55 | 0.553918618311164 | 1.4e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.54 | 0.54128380494478 | 2.1e-5 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)