Bacterial taxon 373153
Protein WP_000395429.1
fructose-6-phosphate aldolase
Streptococcus pneumoniae D39
Gene talC, UniProt A0A0H2ZPP4
>WP_000395429.1|Streptococcus pneumoniae D39|fructose-6-phosphate aldolase
MEFMLDTLNLDEIKKWSEILPLAGVTSNPTIAKREGSINFFERIKDVRELIGSTPSIHVQVISQDFEGILKDAHEIRRQAGDDIFIKVPVTPAGLRAIKVLKKEGYHITATAIYTVIQGLLAIEAGADYLAPYYNRMENLNIDSNSVIRQLVLAIDRQNSPSKILAASFKNVAQVNNALAAGAHAVTAGADVFESAFAMPSIQKAVDDFSDDWFVTQNSRSI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.03 | 2.03073934146757 | 5.2e-20 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.94 | 1.93694000678303 | 5.0e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.88 | 1.87746644519214 | 4.3e-17 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)