Bacterial taxon 373153
Protein WP_000712093.1
fluoride efflux transporter CrcB
Streptococcus pneumoniae D39
Gene crcB2, UniProt A0A0H2ZQN3
>WP_000712093.1|Streptococcus pneumoniae D39|fluoride efflux transporter CrcB
MKKEQFYPLGIFLAAMLGGLVRYLVSTWLPASPDFPWGTLFVNYLGIFCLIFLVKGYLVYKGTSKGLILALGTGFCGGLTTFSSLMLDTVKLLDTGRYFSLVLYLLLSIGGGLLLAYFLGRKKW
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.31 | 2.31243129777144 | 8.0e-55 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.92 | 1.91634989429688 | 8.5e-38 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.75 | 1.74749361227124 | 1.3e-31 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)