Bacterial taxon 373153
Protein WP_000237398.1
fluoride efflux transporter CrcB
Streptococcus pneumoniae D39
Gene crcB1, UniProt A0A0H2ZMJ4
>WP_000237398.1|Streptococcus pneumoniae D39|fluoride efflux transporter CrcB
MVIVYLAIACGFGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAILATGFCGGLTTFSTLNDELQRLLSDKKVFYSYLILTYLGGLVAIFLGILL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.2 | 2.19903018829687 | 1.3e-51 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.98 | 1.97900939737116 | 8.5e-42 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.8 | 1.80456394161989 | 6.3e-35 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)