Bacterial taxon 373153
Protein WP_000580659.1
flavin reductase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPK0
>WP_000580659.1|Streptococcus pneumoniae D39|flavin reductase
MIGVVARENAAEQIKQYQKFTVNISDETSMLAMEQAGFISHQEKLERLGVHYEISERTQIPILDACPLVLDCRVDRIVEEDGICHIFAKILERLVAPELLDEKGHFKNQLFAPTYFMGDGYQRVYRYLDKRVDMKGSFIKKARKKDGKN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.85 | -0.854556815456355 | 2.6e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.78 | -0.781360505570023 | 2.1e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.53 | -0.528626957193482 | 0.0044 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)