Host taxon 9606
Protein NP_001107781.1
ETS-related transcription factor Elf-3
Homo sapiens
Gene ELF3, UniProt P78545
>NP_001107781.1|Streptococcus pneumoniae D39|ETS-related transcription factor Elf-3
MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSGWKEEEVLQSRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.78 | -2.77726132519405 | 1.7e-35 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.5 | -1.50126032969448 | 8.6e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.03 | -1.02829586864277 | 0.00041 | 27678244 | |
Retrieved 3 of 2 entries in 0.8 ms
(Link to these results)