Host taxon 9606
Protein NP_001414.1
epithelial membrane protein 1
Homo sapiens
Gene EMP1, UniProt P54849
>NP_001414.1|Streptococcus pneumoniae D39|epithelial membrane protein 1
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.15 | 1.14697656419087 | 0.00033 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.12 | 1.12183228510155 | 2.7e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.85 | 0.849893452051458 | 0.01 | 27678244 | |
Retrieved 3 of 2 entries in 1 ms
(Link to these results)