Bacterial taxon 373153
Protein WP_000747408.1
ECF transporter S component
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZML4
>WP_000747408.1|Streptococcus pneumoniae D39|ECF transporter S component
MKKRSNIAPIAIFFATMLVIHFLSSLIFNLFPFPIKPTIVHIPVIIASIIYGPRVGVTLGFLMGLLSLTVNTITILPTSYLFSPFVPNGNIYSAIIAIVPRILIGLTPYLVYKLMKNKTGLILAGALGSLTNTIFVLGGIFFLFGNVYNGNIQLLLATVISTNSIAELVISAILTLAIVPRLQTLKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.94 | 0.941059580179976 | 4.8e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.87 | 0.866101330750036 | 4.3e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.47 | 0.465040487979407 | 0.015 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)