Bacterial taxon 373153
Protein WP_000071672.1
EamA family transporter
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPJ2
>WP_000071672.1|Streptococcus pneumoniae D39|EamA family transporter
MSNSLKGTLLTVVAGIAWGLSGTSGQYLMAHGISALVLTNLRLLIAGGILMLLAYATAKDKILVFLKDRKSLLSLLIFALIGLFLNQFAYLSAIQETNAGTATVLQYVCPVGILIYSCIKDRVAPTLGEIVSIIFAIGGTFLIATHGQLDQLSMTPAGLFWGLFSALTYALYIILPIALIKKWGSSLVIGVGMVIAGLVALPFTGVLQADIPTSLDFLLAFAGIILIGTVFAYTAFLKGASLIGPVKSSLLASIEPISAIFFAFLIMNEQFYPIDFLGMAMILFAVTLISLKDLFLEK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.94 | -1.93557604385017 | 4.2e-37 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.35 | -1.34507542697774 | 2.4e-18 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.83 | -0.829636977837043 | 7.2e-8 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)