Bacterial taxon 373153
Protein WP_000079358.1
DUF956 family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNM8
>WP_000079358.1|Streptococcus pneumoniae D39|DUF956 family protein
MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQFIQIPWSHINQIGANVTGRKISRHFEVFTDKGKFLFASKDSGAILKIAREKLGNDKVVKLPTLIQTISQKFKNLFAKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.83 | 1.82961614019064 | 9.2e-54 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.53 | 1.52767709247128 | 1.3e-37 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.4 | 1.39769728670243 | 1.3e-31 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)