Bacterial taxon 373153
Protein WP_000285191.1
DUF951 family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZNI8
>WP_000285191.1|Streptococcus pneumoniae D39|DUF951 family protein
MYQVGNFVEMKKPHACTIKSTGKKANRWEITRVGADIKIKCSNCEHVVMMGRYDFERKMNKIID
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.35 | 1.34972089714699 | 2.6e-30 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.19 | 1.18749652658653 | 6.3e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.98 | 0.981563121716635 | 3.1e-16 | 27678244 | |
Retrieved 3 of 1 entries in 0.6 ms
(Link to these results)