Bacterial taxon 373153
Protein WP_000895040.1
DUF948 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLW8
>WP_000895040.1|Streptococcus pneumoniae D39|DUF948 domain-containing protein
MLEVAYILVALALIVFLVYLIITVQKLGRVIDETEKTIKTLTSDVDVTLHHTNELLAKVNVLADDINVKVATIDPLFSAVADLSLSVSDLNDHARVLSKKASSAGSKTLKTGASLSALRLASKFFKK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.49 | 0.494709787349927 | 2.2e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.49 | 0.490834156267069 | 2.9e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.45 | 0.454975763652122 | 0.00011 | 27678244 | |
Retrieved 3 of 1 entries in 0.3 ms
(Link to these results)