Bacterial taxon 373153
Protein WP_000186955.1
DUF4231 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZND7
>WP_000186955.1|Streptococcus pneumoniae D39|DUF4231 domain-containing protein
MTPEEMYLTERLDVQIAHFLKKSVQHRRRYKVLKITEIVAGFLIAVFCAIPMPGDRYRLISVALSSLGLLCEGIINLYNAKENWISYQKTAQLLEKEKFLYQCQTEKYAGKTKAFALFVKTCEGLISEEINQWESIQSKEVAASADAPVKKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.56 | 2.56136146340345 | 6.0e-60 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ 2.33 | 2.33183479820348 | 5.3e-50 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.89 | 1.89354405313545 | 3.1e-33 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)