Bacterial taxon 373153
Protein WP_001041547.1
DUF3272 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZL53
>WP_001041547.1|Streptococcus pneumoniae D39|DUF3272 domain-containing protein
MNKQQFIIMALFTAAETYFFNEAWMTGRYIMAAFWAILLFRNFRVSYVMGKIVDVIDQHFNRKD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.33 | -1.32553867815221 | 8.1e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.26 | -1.26037614398951 | 5.1e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.13 | -1.13203797817175 | 1.1e-6 | 27678244 | |
Retrieved 3 of 1 entries in 1.6 ms
(Link to these results)