Bacterial taxon 373153
Protein WP_000262800.1
DUF3165 family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLP7
>WP_000262800.1|Streptococcus pneumoniae D39|DUF3165 family protein
MVYLVLGILLLLLYVFATPESIKGTVNIVAMVCILVALLILLVLSFLKIFQLPTEIFLAIAMLILAYFSVRDITLMPVKKSKRR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.78 | -1.78244548755072 | 1.3e-37 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.39 | -1.38571528420836 | 4.1e-23 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.12 | -1.11993751390326 | 1.6e-15 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)