Bacterial taxon 373153
Protein WP_000257105.1
DUF3013 family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMD0
>WP_000257105.1|Streptococcus pneumoniae D39|DUF3013 family protein
MATYGFLDVLEEELDKNFPFDFEISWDKRNHAVEVSFLLEAQNAAGVEMVDEDGEVSSDDILFEEAVLFYNPAKSTVNEEDYLTVIPYLPKKGFSREFLAYFALFLKDTAEVGLDVLMDFLEDPEAEEFVMEWNQEVFEEGKVGLEEGEFYPYPRY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.72 | 0.721207839582183 | 1.0e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.48 | 0.476265872105671 | 0.00059 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.4 | 0.400137112611825 | 0.0041 | 27678244 | |
Retrieved 3 of 1 entries in 2.1 ms
(Link to these results)