Bacterial taxon 373153
Protein WP_000455066.1
DUF2273 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZM81
>WP_000455066.1|Streptococcus pneumoniae D39|DUF2273 domain-containing protein
MEWLKQYRYPIIAGLIGVFLACLIVSFGFFKTIFVLILGALGVAAGLYIEKNYIDK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.09 | -3.09314912562405 | 8.3e-61 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.36 | -2.36473232082626 | 1.2e-38 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.55 | -0.548907705773427 | 0.0028 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)