Bacterial taxon 373153
Protein WP_000078805.1
DUF2200 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMX0
>WP_000078805.1|Streptococcus pneumoniae D39|DUF2200 domain-containing protein
MSQKLYNMKFAAVYLALIAKVERKGGKAESVHQVTSWLTGYEVSDVLACLDRDVTYGDFFRQAPYYVPERIAITGKICGVRIEEIDDPLMQEIRRLDKLVDWLAKGKTSQQVLEKYEKHK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ 1.59 | 1.58582231766607 | 8.6e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.46 | 1.45579801986838 | 2.5e-8 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.43 | 1.4336709906889 | 2.6e-8 | 27678244 | |
Retrieved 3 of 1 entries in 0.4 ms
(Link to these results)