Bacterial taxon 373153
Protein WP_000863509.1
DUF1831 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZLI7
>WP_000863509.1|Streptococcus pneumoniae D39|DUF1831 domain-containing protein
MAFEKIIQLKNCRYDYTLSPSVKKFTLKDNTFFETKVGNYELTRLLEKVPNSGEGFQLKIIINKELTGAKINITDKFGLRLVDIFKSEDHHIHQEKFYFLMDSLVERGVFTKSER
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.88 | 0.881337291392284 | 1.6e-13 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.49 | 0.489691328798596 | 5.0e-5 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.47 | 0.469534626572238 | 0.00012 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)