Bacterial taxon 373153
Protein WP_000198679.1
DUF1700 domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN93
>WP_000198679.1|Streptococcus pneumoniae D39|DUF1700 domain-containing protein
MTRTEYLTQLELYLKKLPEADRIEAMDYFRELFDDAGIEGEEELIASLGTPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTLFAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSLVLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ -2.57 | -2.57078200783976 | 7.6e-77 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.89 | -1.88839254938922 | 2.8e-42 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.58 | -1.57553540379944 | 2.7e-31 | 27678244 | |
Retrieved 3 of 1 entries in 0.9 ms
(Link to these results)