Bacterial taxon 373153
Protein WP_000131446.1
dTDP-4-dehydrorhamnose 3,5-epimerase
Streptococcus pneumoniae D39
Gene cps2M, UniProt Q9ZIH5
>WP_000131446.1|Streptococcus pneumoniae D39|dTDP-4-dehydrorhamnose 3,5-epimerase
MTDNFFGKILAVRKIDAIPGMLEFDIPVHGDNRGWFKENFQKEKMEPLGFPESFFAEGKLQNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQTIIDASKGIFVPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPSLGIEWENIAEAEVSEADKHHPLLKDVKPLKKEDL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.61 | -2.6112433795747 | 4.6e-11 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.51 | -1.51304724678433 | 0.00019 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.26 | -1.25562279075016 | 0.002 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)