Bacterial taxon 373153
Protein WP_000704762.1
DNA topology modulation protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZP77
>WP_000704762.1|Streptococcus pneumoniae D39|DNA topology modulation protein
MKITIIGYSGSGKSTLAEKLSNYYSIPKLHMDTLQFQPGWQDSDCEWMLTEIKNFLTKHKAWVIDGNYSWCYYQERMQEADQIIFLNFLPLTCLFRAFKRYLKYRGKVRESMAADCPERFEWEFIRWILWDGRSKTQKENYQKLCQEYSHKVTILRNQRELDQFLDKKRKSYNS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.53 | -2.52606065426797 | 4.9e-50 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.18 | 1.1805438907787 | 3.6e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.51 | -0.514169212584501 | 0.0034 | 27678244 | |
Retrieved 3 of 1 entries in 0.8 ms
(Link to these results)