Host taxon 9606
Protein NP_001181982.1
DNA damage-inducible transcript 3 protein isoform 1
Homo sapiens
Gene DDIT3, UniProt P35638
>NP_001181982.1|Streptococcus pneumoniae D39|DNA damage-inducible transcript 3 protein isoform 1
MELVPATPHYPADVLFQTDPTAEMAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 2 h | ●●●●○ -3.03 | -3.02751451241468 | 1.3e-53 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.78 | -1.77623895566184 | 2.3e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | host | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.89 | -0.889129130105958 | 2.6e-5 | 27678244 | |
Retrieved 3 of 2 entries in 1.9 ms
(Link to these results)