Bacterial taxon 373153
Protein WP_000241398.1
DJ-1/PfpI family protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZPQ4
>WP_000241398.1|Streptococcus pneumoniae D39|DJ-1/PfpI family protein
MVKVAVMLAQGFEEIEALTVVDVLRRANITCDMVGFEEQVTGSHAIQVRADHVFDGDLSDYDMIVLPGGMPGSAHLRDNQTLIQELQSFEQEGKKLAAICAAPIALNQAEILKNKRYTCYDGVQEQILDGHYVKETVVVDGQLTTSRGPSTALAFAYELVEQLGGDAESLRTGMLYRDVFGKNQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.81 | -0.810127493063065 | 1.3e-10 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.64 | -0.635314093127521 | 7.5e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.37 | -0.373245485401866 | 0.004 | 27678244 | |
Retrieved 3 of 1 entries in 1.6 ms
(Link to these results)