Bacterial taxon 373153
Protein WP_000710119.1
diacylglycerol kinase family lipid kinase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZRQ7
>WP_000710119.1|Streptococcus pneumoniae D39|diacylglycerol kinase family lipid kinase
MKKAMVIINPTSGGEKALDYKEKLENKAKEYFEYVETKITEKVLDATHFAEEASREQYDAVVVFGGDGTVNEVISGIDERDYIPKLGIIPGGTGNLITKLLEINQDIDGAIDELDFDLTNKIDIGKANDNYFGYIFSIGSLPEAIHNVEIEDKTKFGILTYAVNTMKSVMTDQVFNIKVETENGNYVGEASHVLVLLTNYFADKKIFEENKDGYANILILKDASIFSKLSVIPDLLKGDVVANDNIEYIKARNIKISSDSELESDVDGDKSDNLPVEIKVLAQRVEVFSKPKED
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.01 | 1.00909393496022 | 4.0e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.8 | 0.802919758077684 | 0.00029 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.48 | 0.475389826344916 | 0.035 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)