Bacterial taxon 373153
Protein WP_000516190.1
dephospho-CoA kinase
Streptococcus pneumoniae D39
Gene coaE, UniProt A0A0H2ZR88
>WP_000516190.1|Streptococcus pneumoniae D39|dephospho-CoA kinase
MGKIIGITGGIASGKSTVTNFLRQQGFQAVDADAVVHQLQKPGGRLFEALVQHFGQEIILENGELNRPLLASLIFSNPEEQKWSNQIQGEIIREELATLREQLAQTEEIFFMDIPLLFEQDYSDWFAETWLVYVDRDAQVERLMKRDQLSKDEAESRLAAQWPLEKKKDLASQVLDNNGNQNQLLNQVHILLEGGRQDDRD
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ -1.78 | -1.77500974123181 | 6.4e-41 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ -1.77 | -1.76940067913389 | 1.0e-39 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.27 | -1.26558907150591 | 2.4e-21 | 27678244 | |
Retrieved 3 of 1 entries in 0.7 ms
(Link to these results)