Bacterial taxon 373153
Protein WP_000136976.1
deoxycytidylate deaminase
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZN16
>WP_000136976.1|Streptococcus pneumoniae D39|deoxycytidylate deaminase
MTEKRLAWDEYFAAQALLIANRSTCKRAKVGAILVKDNKVISTGYNGSVSGTEHCIDHECLVIEGHCVRTLHAEVNAILQGAERGVPKGFTAYVTHFPCLNCTKQLLQVGCKRVVYINQYRMDDYAQYLYQEKGTELTHLPLETVQTALKEADLM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●●○○ 2.02 | 2.01961838793255 | 1.6e-45 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.91 | 1.90978015716207 | 2.9e-40 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.8 | 1.80445118359934 | 6.6e-37 | 27678244 | |
Retrieved 3 of 1 entries in 1.3 ms
(Link to these results)