Bacterial taxon 373153
Protein WP_000351967.1
D-alanine--poly(phosphoribitol) ligase subunit DltC
Streptococcus pneumoniae D39
Gene dltC, UniProt Q04HZ9
>WP_000351967.1|Streptococcus pneumoniae D39|D-alanine--poly(phosphoribitol) ligase subunit DltC
MDIKSEVIEIIDELFMEDVSDMMDEDLFDAGVLDSMGTVELIVEIENRFDIRVPVTEFGRDDWNTANKIIAGIVELQNA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ -0.65 | -0.649431411637688 | 6.9e-7 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ -0.63 | -0.631207991052494 | 2.0e-6 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ -0.42 | -0.419129527791226 | 0.0017 | 27678244 | |
Retrieved 3 of 1 entries in 1.9 ms
(Link to these results)