Bacterial taxon 373153
Protein WP_000681292.1
CYTH domain-containing protein
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZMW8
>WP_000681292.1|Streptococcus pneumoniae D39|CYTH domain-containing protein
MKHLEIELKTLLKKDEYNRLKDQFTGVTPVLQTNYYIDTPDFELREKKVAMRIRTFEDWAELTLKVPQSVGNMEYNQKLQLKDAENYLSKEELPQGLVLDELAKHGIQSKNWQVLGCLTTLRYEMKTAIGLMALDQSRYFDITDYELELEVENHEQGKQDFRQFLEKNQISYQKAPSKLVRFVKSMKNS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●●○○ 2.35 | 2.35148144872793 | 1.0e-77 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.76 | 0.756625786712378 | 5.6e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.67 | 0.670322950504831 | 2.1e-7 | 27678244 | |
Retrieved 3 of 1 entries in 1.1 ms
(Link to these results)