Bacterial taxon 373153
Protein WP_001211279.1
CtsR family transcriptional regulator
Streptococcus pneumoniae D39
Gene ctsR, UniProt A0A0H2ZPV6
>WP_001211279.1|Streptococcus pneumoniae D39|CtsR family transcriptional regulator
MRFKNTSDHIEAYIKAILDQSGIVELQRSQLADTFQVVPSQINYVIKTRFTESRGYLVESKRGGGGYIRIGRIEFSSHHEMLRELLYSIGERVSQEIYEDILQLLVEQELMTKQEMNLLVSVALDRVLGEEAPVVRANMLRQVIQEVDRKGK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●○○○ 1.14 | 1.13918370939766 | 2.5e-17 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●○○○○ 0.81 | 0.805990560839447 | 3.6e-9 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.34 | 0.338244868333629 | 0.016 | 27678244 | |
Retrieved 3 of 1 entries in 1.4 ms
(Link to these results)