Bacterial taxon 373153
Protein WP_000771241.1
CPBP family intramembrane metalloprotease
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZQD6
>WP_000771241.1|Streptococcus pneumoniae D39|CPBP family intramembrane metalloprotease
MKLLKNLGWILLALLSFLFIYGFIQGLATASLALGASPYAVTLLYVALAGVYVYGIYKWYQKAPVYIEKSGFNRFIWLPALVWFLSLVVQFFLPDDPSVNQQIATDLTLSQPLFSFFAVVIFAPLTEEIVFRGMLARYLFPKQDNSKRTLIFLLVSSLLFALIHFPGDVQQFFVYFSLGFSLGLAYISRKGLVYSISLHALNNLVGFLMILML
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.06 | 1.05564253970895 | 4.9e-16 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●○○○○ 0.92 | 0.91711039794317 | 1.4e-12 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●○○○○ 0.55 | 0.549667429798235 | 3.4e-5 | 27678244 | |
Retrieved 3 of 1 entries in 1 ms
(Link to these results)