Bacterial taxon 373153
Protein WP_000394036.1
CPBP family intramembrane metalloprotease
Streptococcus pneumoniae D39
Gene n/a, UniProt A0A0H2ZM24
>WP_000394036.1|Streptococcus pneumoniae D39|CPBP family intramembrane metalloprotease
MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSLLVTSLSVAYARKFEMISFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAEVSRGISLSLILTTSVFGPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPSFIFYLLGGLLLGLAYKKSQNLWVSTLVHMFYNSWPLLYYL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 30 min | ●●●○○ -2.32 | -2.318572928761 | 8.9e-22 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 1 h | ●●○○○ -1.81 | -1.8140877509489 | 9.7e-14 | 27678244 | |
| Human (Homo sapiens) | 9606 | Streptococcus pneumoniae D39 | 373153 | pathogen | Human type II lung epithelial cell line A549 | 2 h | ●●○○○ 1.59 | 1.59396402232983 | 5.5e-11 | 27678244 | |
Retrieved 3 of 1 entries in 1.2 ms
(Link to these results)